Request access to LULA-1 weights
Access requests are reviewed individually by Om Therapeutics.
For testing without downloading model weights, use hosted LULA at https://omtx.ai
and contact dmc@omtx.ai to request tester Wallet Credits.
Downloading or using these materials is governed by the Om LULA Community
License 1.3. Submitting this form does not grant access or any commercial
rights. Commercial use outside Permitted Om Fulfillment requires a separate
written Om commercial license.
Log in or Sign Up to review the conditions and access this model content.
License notice. By downloading, accessing, using, distributing, or creating a derivative of LULA-1, you agree to the Om LULA Community License 1.3. LULA-1 is open-weight, not OSI open source. It may be used for research, evaluation, benchmarking, teaching, local inference, local fine-tuning, and Permitted Om Fulfillment Use. Commercial local/open-weight use outside Om Fulfillment, hosted API/SaaS access, resale, paid support or deployment, product bundling, and competing model services require a separate written Om commercial license. You may not publish, distribute, or make available raw or bulk LULA-1 Outputs, including scores, predictions, rankings, embeddings, screened molecule lists, or benchmark datasets, unless Om gives prior written approval. Public disclosure rights are limited to customer-derived experimental data, analyses, conclusions, and reports from molecules purchased through Om Fulfillment. For commercial licensing, contact dmc@omtx.ai.
+
+
+
omtx.ai
Open-weight release track
LULA-1 — sequence-only protein–ligand scoring.
Protein amino-acid sequence plus ligand SMILES in, binding score out. No structure input, no docking, no folding step.
Sequence-only Local inference Open weights
Model at a glance
1.7M parameters 6.8 MB Sequence-only Local inference Open weights Public AUROC 0.7615 EF@1000 54.8×LULA-1
LULA-1 is a lightweight, fast, sequence-only protein–ligand binding scorer, trained on ~500M data points from Om and public sources. It takes a protein amino-acid sequence and a ligand SMILES string and returns a binding score. There is no structure input, no docking, and no folding step.
It is fast because of how it is built: the protein is embedded once, and every additional ligand costs only a projection and a cosine similarity. That is what makes screening a million-molecule library practical.
The intended public interface is deliberately small:
score(protein_sequence: str, smiles: str | list[str]) -> record | list[record]
What this release contains
LULA-1 ships as a compact scoring head that runs on top of two public pretrained encoders. The checkpoint is 6.8 MB — 1,705,984 parameters. This makes the released Om weights easy to verify, cache, and move between local environments while using widely available protein and molecule representations at inference time.
Parameters
| Component | Parameters | Source |
|---|---|---|
| LULA-1 scoring head | 1,705,984 | this repository |
| ESM-2 650M — protein encoder (1280-dim) | 652,358,616 | facebook/esm2_t33_650M_UR50D |
| ChemBERTa-77M-MTR — ligand encoder (384-dim) | ~3,500,000 | DeepChem/ChemBERTa-77M-MTR |
| Total at inference | ~657.6M |
The scoring head is ~0.26% of the parameters in play at inference. Breakdown of the checkpoint:
| Tensor | Shape | Parameters |
|---|---|---|
protein_projector.weight |
1024 × 1280 | 1,310,720 |
protein_projector.bias |
1024 | 1,024 |
ligand_projector.weight |
1024 × 384 | 393,216 |
ligand_projector.bias |
1024 | 1,024 |
| Total | 1,705,984 |
The checkpoint also carries score_logit_scale (10.0), a scalar loaded as a Python float rather
than a tensor — it is a persisted hyperparameter, not a trainable parameter, and is excluded from
the count above.
Architecturally this is a ConPLex-style contrastive scorer: each encoder output is passed through a
single Linear → GELU → Dropout projection to a shared 1024-dim space, L2-normalized, compared by
cosine similarity, scaled by the logit scale persisted in the checkpoint, and passed through a
sigmoid. The output is a probability-like score in [0, 1].
The omtx lula download command downloads the LULA-1 weights and the required public encoder assets
into the local cache for scoring. Om distributes the LULA-1 scoring head in this repository; the
third-party encoders remain governed by their own upstream terms.
Usage
Quickstart notebook: notebooks/lula1_quickstart.ipynb —
install, download, verify, and score a real target end to end. CPU works; GPU is faster.
Full workflow cookbooks:
LULA Score To Order,
Om Accessible Space To Order, and
Explicit SMILES.
pip install "omtx[lula]>=2.0.20"
hf auth login # required for gated LULA-1 weights; say no to adding the token as a git credential
omtx lula download --model lula1
omtx lula verify --model lula1
from omtx.lula import load_model
CA2 = (
"MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRIL"
"NNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHL"
"VHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDP"
"RGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELM"
"VDNWRPAQPLKNRQIKASFK"
)
mols = [
"CC(=O)Nc1nnc(s1)S(N)(=O)=O",
"Cc1ccc(cc1)S(=O)(=O)N",
"CC(C)Cc1ccc(cc1)C(C)C(=O)O",
"CCN(CC)CCNC(=O)c1ccc(N)cc1",
"c1ccc(cc1)C(=O)O",
"CCO",
]
model = load_model("lula1")
for row in sorted(model.score(protein_sequence=CA2, smiles=mols), key=lambda r: r["rank"]):
print(row["rank"], round(row["score"], 4), row["smiles"])
Verified in Google Colab on 2026-07-29. LULA-1 is gated on Hugging Face, so run
hf auth login or pass a Hugging Face token before omtx lula download.
Expected CA2 ranking:
1 0.9995 CC(=O)Nc1nnc(s1)S(N)(=O)=O
2 0.9991 Cc1ccc(cc1)S(=O)(=O)N
3 0.2331 CCO
4 0.1643 CCN(CC)CCNC(=O)c1ccc(N)cc1
5 0.1518 CC(C)Cc1ccc(cc1)C(C)C(=O)O
6 0.0984 c1ccc(cc1)C(=O)O
Batch scoring returns, per molecule: score, rank, and top_percentile_in_batch.
rank and top_percentile_in_batch are computed within the batch you submit, making the output
directly useful for prioritizing a candidate set.
Common Workflows
Use smiles=[...] when you want to score molecules you already have. This is
local open-weight scoring after model and encoder setup.
from omtx.lula import load_model
protein_sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQANN"
smiles = [
"CCOc1ccc2nc(S(N)(=O)=O)sc2c1",
"Cn1ccnc1CCNCc1cn(-c2ccc(F)c(Cl)c2)nn1",
"CCO",
]
model = load_model("lula1")
scores = model.score(protein_sequence=protein_sequence, smiles=smiles)
Use source="om" and a Wallet Credit tier when you want Om to return orderable
molecules from Om Accessible Space. This requires an Om API key. For local
open-weight scoring, the SDK fetches the authenticated molecule slice without
sending your protein sequence to Om.
from omtx import OmClient
from omtx.lula import load_model
protein_sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQANN"
with OmClient(api_key="your-api-key") as client:
model = load_model("lula1")
scores = model.score(
protein_sequence=protein_sequence,
source="om",
tier=50,
n=50000,
client=client,
)
Only Om Accessible Space rows include source_metadata and can be ordered
directly with Wallet Credits:
from uuid import uuid4
from omtx import OmClient
selected = sorted(scores, key=lambda row: row["score"], reverse=True)[:96]
with OmClient(api_key="your-api-key") as client:
order = client.molecules.order(
items=selected,
shipping_address_id="your-shipping-address-id",
idempotency_key=f"order-round-1-{uuid4()}",
)
Om Accessible Space Without LULA
Install omtx>=2.0.23 when using the molecule-only helpers.
You can also fetch Om Accessible Space molecules, score or filter them with your own tools, and order selected rows through Om:
from omtx import OmClient
with OmClient(api_key="your-api-key") as client:
pool = client.molecules.accessible_space(
tier=50,
n=50000,
seed=123,
idempotency_key="target-a-om-space-slice-1",
)
# smiles is a plain list[str], one SMILES per molecule.
smiles = client.molecules.smiles(pool)
# scores must be a same-length list[float], one score per SMILES.
scores = score_with_your_model(smiles)
# with_scores adds your scores back to the orderable Om rows.
scored_rows = client.molecules.with_scores(pool, scores)
selected = sorted(scored_rows, key=lambda row: row["score"], reverse=True)[:96]
order = client.molecules.order(
items=selected,
shipping_address_id="your-shipping-address-id",
idempotency_key="molecule-order-1",
)
The SDK keeps the Om order metadata needed to revalidate fixed Wallet Credit price and route fulfillment internally. This path still requires an Om API key and Wallet Credits, but it does not require LULA scoring.
Intended use
Ranking and triage of compound sets against a protein target — particularly where no structure is available, or where a structure-based method would be too slow across the full set. LULA-1 returns a relative score for prioritization.
Your data stays local
Scoring and fine-tuning run entirely on your machine. Nothing about your targets or compounds is transmitted to Om.
omtx lula scoreand local fine-tuning make no network calls. Protein sequences, SMILES, labels, scores, and checkpoints never leave your environment.- There is no telemetry in the local path — no usage pings, no analytics, no phone-home.
omtx lula downloadis the only command that uses the network. It fetches the weights and the two public encoders, and sends nothing about your data.- After that download, the whole path runs offline. Point
OMTX_LULA_HOMEat a shared cache and scoring works on an air-gapped machine.
This is a property of the code, not a policy promise: the scoring module contains no HTTP client and no network imports. It is verifiable by inspection of the published package.
For teams that cannot send proprietary targets or compound libraries to a third-party API, this is the point of an open-weight release.
Free to Use With Om Fulfillment
You may use LULA-1 locally, including local fine-tuning, to select, prioritize, order, and test molecules through Om.
If you purchase molecules through Om Fulfillment, you may use the resulting customer-derived experimental data, assay results, validation data, analyses, conclusions, and reports internally and commercially for your own discovery programs, subject to the License and the applicable Om fulfillment, platform, or enterprise agreement.
You may not resell LULA-1, host it as an API/SaaS, provide LULA-powered services to third parties, or use LULA-1 as a free internal commercial screening engine while ordering or testing outside Om. Those uses require a separate Om commercial license.
You own your targets, compounds, and Customer-Derived Om Fulfillment Data, subject to the applicable Om fulfillment, platform, or enterprise agreement. This does not include a right to publish raw or bulk LULA-1 Outputs, scores, predictions, rankings, embeddings, screened molecule lists, virtual screening results, or benchmark datasets without Om's prior written approval.
Hosted models and fulfillment
LULA-1's weights are open-weight so you can screen locally with no dependency on Om. Three things are available from Om when you want more than that:
Hosted LULA-1 — the same model, no local setup, no encoder downloads, no GPU. Useful for large screens and for teams that want managed runs and tracking. omtx.ai/models
LULA-2 — Om's cross-attention successor for higher-resolution protein-ligand ranking. It reads the protein and ligand together rather than scoring from independent embeddings. Public weights are available on Hugging Face and hosted scoring is available through Om. huggingface.co/omtx/lula-2
Molecule Fulfillment — once you have a ranked shortlist, order the physical compounds through Om with Wallet Credits and track order status in one flow. LULA Score To Order
Pricing for hosted scoring is at omtx.ai/pricing.
A practical pattern: screen wide and cheap with open-weight LULA-1, then use Om's hosted models and fulfillment tools for managed runs, ordering, and final prioritization.
What ships
| Path | |
|---|---|
model/best.pt |
Scoring-head checkpoint |
model/model_config.json |
Model configuration |
release_manifest.json |
Machine-readable hashes used by omtx lula verify |
checksums.txt |
Human-readable SHA256 list |
examples/ |
Runnable scoring examples |
LICENSE, NOTICE |
Terms and third-party components |
Use is governed by LICENSE. Third-party pretrained encoders are governed by their own terms. This
release package focuses on the LULA-1 scoring head, verification assets, examples, and
documentation.
Training data
LULA-1 was trained on ~500 million data points from Om and public sources.
Evaluation
LULA-1 is evaluated as a ranking model for hit triage. Scores are optimized for prioritizing candidate molecules within a target-specific screening set.
Public metrics
The LULA-1 release checkpoint is lula1_v6.
| Metric | LULA-1 v6 |
|---|---|
| Public validation AUROC | 0.7615 |
| Proteome-scale macro AUROC | 0.633 |
| Proteome-scale aggregate EF@1000 | 54.8× |
Proteome-scale sweep
LULA-1 was also evaluated in a large proteome-scale ranking sweep.
| Proteins scored | 10,569 |
| Protein–ligand pairs scored | 10,575,246,882 |
| Known binders | 5,025,463 |
| Macro AUROC | 0.633 |
| Median AUROC | 0.678 |
| Aggregate EF@1000 | 54.8× |
EF@1000 measures top-of-list enrichment: across the sweep, LULA-1 found 267,324 known binders in the top-1000 ranked molecules per target, versus 4,877.6 expected under random ranking.
Enrichment by target evidence
LULA-1 enrichment improves as more target evidence is available:
| Known binders | Proteins | Median AUROC | Mean P@1000 | Expected P@1000 | Implied EF |
|---|---|---|---|---|---|
| 1-9 | 4,910 | 0.648 | 0.0092% | 0.0003% | ~31× |
| 10-49 | 2,230 | 0.610 | 0.1016% | 0.0024% | ~42× |
| 50-199 | 1,528 | 0.686 | 0.6811% | 0.0103% | ~66× |
| 200-999 | 1,102 | 0.738 | 3.8868% | 0.0470% | ~83× |
| >=1000 | 799 | 0.810 | 26.4541% | 0.5175% | ~51× |
Target-level results
Per-protein metrics from the proteome-scale sweep, for well-known drug targets.
EF is AUPR divided by the target's observed positive rate in the ranked sweep.
| Target | UniProt | Known binders | AUROC | AUPR | EF |
|---|---|---|---|---|---|
| KIT | P10721 | 5,354 | 0.891 | 0.1005 | 19× |
| PIM1 | P11309 | 9,127 | 0.887 | 0.3810 | 42× |
| PARP1 | P09874 | 6,982 | 0.878 | 0.3436 | 50× |
| ALK | Q9UM73 | 4,265 | 0.876 | 0.1802 | 42× |
| BACE1 | P56817 | 15,149 | 0.876 | 0.4582 | 31× |
| BTK | Q06187 | 14,504 | 0.873 | 0.1465 | 10× |
| CA2 | P00918 | 10,901 | 0.870 | 0.5495 | 51× |
| HDAC1 | Q13547 | 12,855 | 0.853 | 0.5510 | 43× |
| CDK2 | P24941 | 16,693 | 0.845 | 0.2298 | 14× |
| MTOR | P42345 | 10,258 | 0.824 | 0.1394 | 14× |
| ABL1 | P00519 | 5,808 | 0.808 | 0.0540 | 9× |
| EGFR | P00533 | 18,363 | 0.788 | 0.1895 | 11× |
| ESR1 | P03372 | 7,815 | 0.757 | 0.2192 | 28× |
| AR | P10275 | 5,551 | 0.724 | 0.0799 | 14× |
Kinases and well-characterized enzyme families rank strongly. Target-level metrics and batch rankings help prioritize each campaign.
License
Weights are released under the Om LULA Community License 1.3. By downloading,
accessing, using, distributing, or creating a derivative of LULA-1, you agree to
that license. See LICENSE for the full terms and NOTICE for third-party
components.
Summary (the LICENSE file governs):
- Allowed without a separate paid model license - non-commercial research, evaluation, benchmarking, teaching, security testing, local inference, local fine-tuning, non-commercial demos, using LULA-1 to select, prioritize, order, test, or generate data through Om, and use or publication of Customer-Derived Om Fulfillment Data as allowed by the License and the applicable Om agreement.
- Output publication restriction - raw or bulk LULA-1 Outputs, including scores, predictions, rankings, embeddings, screened molecule lists, virtual screening results, or benchmark datasets, may not be published, distributed, or made available without Om's prior written approval.
- Requires a separate Om commercial license - commercial use of local/open- weight LULA-1 itself outside Om Fulfillment, commercial screening or production discovery not fulfilled through Om, self-hosting, monetized hosting, paid API/SaaS access, reselling model access, support/deployment, third-party services, bundling LULA-1 into a paid product, or building a competing model API around Om weights.
- Commercial licensing contact - email dmc@omtx.ai.
- Publication attribution required - permitted public papers, preprints,
reports, or presentations using Customer-Derived Om Fulfillment Data must cite
Om Therapeutics Inc. LULA-1, checkpoint
lula1_v6, and the Hugging Face model page.
Attribution
LULA-1's architecture is derived from ConPLex, developed at MIT.
Singh, R., Sledzieski, S., Bryson, B., Cowen, L., & Berger, B. (2023). Contrastive learning in protein language space predicts interactions between drugs and protein targets. Proceedings of the National Academy of Sciences, 120(24). doi:10.1073/pnas.2220778120
Reference implementation: github.com/samsledje/ConPLex (MIT License).
If you use LULA-1 in published work, please cite the ConPLex paper alongside Om.
Links
- Om — https://omtx.ai
- Hosted models — https://omtx.ai/models
- Pricing — https://omtx.ai/pricing
- GitHub — https://github.com/omtx-ai
- Downloads last month
- -